33%

IGF-DES 1mg

Residue Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Solubility: 100 μg/mL sterile diluent (distilled de-ionized water)
Molar Mass: 7371.4 g/mol
CAS Number: 112603-35-7
Molecular Formula: C319H501N91O96S7
MG: 1 MG

$80.00 $120.00

Wishlist Wishlist Wishlist
SKU202011 Category